Recombinant Human FGF-Acidic: Carrier-Ready-To-Use

(For Research Use Only)

Availability: In stock

Catalog # Amount Price Tiered Pricing Qty
12-0004CR-005 5 µg
$49.00
12-0004CR-010 10 µg
$70.00
12-0004CR-025 25 µg
$150.00
12-0004CR-050 50 µg
$180.00
12-0004CR-100 100 µg
$280.00
12-0004CR-250 250 µg
$350.00
12-0004CR-01M 1.0 mg
$1,200.00
Please inquire about custom configurations or bulk packaging.
  • OR
    Recombinant human Fibroblast Growth Factor-acidic (aFGF) (140AA), also called as FGF-1, HBGF-1, ECGF-beta, is a non-glycosylated heparin binding growth factor that is expressed in the brain, kidney, retina, smooth muscle cells, bone matrix, osteoblasts, astrocytes and endothelial cells. FGF-acidic has the ability to signal through all the FGF receptors. Aurora Biolabs’ Recombinant human FGF-acidic is a 15.8 kDa protein consisting of 140 amino acid residues.

    Base

    Double click on above image to view full picture

    Zoom Out
    Zoom In

    More Views

    • Base

    Scientific Details

    AA Sequence:
    FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAE SVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYIS KKHAEKNWFVGLKKNGSCKRGPRTHYGQKA ILFLPLPVSSD
    Endotoxin:
    < 1.0 EU/ μg of protein as determined by the LAL assay
    Bioactivity:
    ED50 < 0.1 ng/ml as determined by its ability to the dose dependent proliferation of mouse Balb/c 3T3 cells.
    Formulation:
    Sterile filtered through a 0.2 micron filter in 1xPBS, 1.0 %BSA.
    Purity:
    Greater than 98%, as determined by SDS-PAGE
    Source:
    Escherichia Coli.
    Storage & Stability:
    This product is shipped on dry ice. It is stable for up to 6 months from date of receipt when stored at -80°C. Multiple freeze/thawcycles should be avoided as it can result in significant loss of activity.

    View / Download Product Data Sheets

    Documentation: