Scientific Details
AA Sequence:
AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Endotoxin:
Less than 0.01 ng/μg cytokine as determined by the LAL assay
Bioactivity:
ED50= 0.1-1.0 ng/ml as determined by the dose dependent proliferation of NIH 3T3 cells (figure-2, 3).
Formulation:
Sterile filtered through a 0.22 micron filter and lyophilized from Tris buffer (10 mM Tris pH7.5, 150 mM NaCl).
Purification:
Sequential chromatography
Purity:
Greater than 98% as determined by SDS-PAGE (figure-1)
Reconstitution:
Centrifuge vial before opening. It is recommended to reconstitute bFGF in sterile 10 mM Tris-HCl, pH 7.5 to yield a stock solution of 0.1 mg/ml of bFGF. It is stable for up to 6 months when stored at -20°C and up to 12 months when stored at -80°C. Multiple freeze/thaw cycles will result in significant loss of activity.
Source:
Escherichia Coli
Storage & Stability:
The product is shipped at ambient temperature with ice bags. Upon receipt, it should be stored immediately at -20 °C to -80 °C. Lyophilized bFGF is stable at -20 °C to -80 °C for up to 16 months.
Suggested Usage:
Useful for cell culture and for the study of signaling pathways.
Catalog # | Product Name |
---|---|
12-0004CFR | |
12-0004CFL | |
12-0012 | Human Eukaryotic Translation Initiation Factor (EIF4E) Complexed With m7GTP |
12-0010 | His-tagged Human Eukaryotic Translation Initiation Factor 4E (EIF4E) |
12-0004CR | |
12-0008 | |
12-0011 | His-tagged Human Eukaryotic Translation Initiation Factor (EIF4E) Complexed With EIF4G |
FOLLOW US