Human FGF-basic: Formulation I- Animal Free-Ready-to-Use

(For Research Use Only)

Availability: In stock

Catalog # Amount Price Tiered Pricing Qty
12-0005AFR-10 10 µg
$95.00
12-0005AFR-50 50 µg
$215.00
12-0005AFR-100 100 µg
$330.00
12-0005AFR-1.0 mg 1.0 mg
$1,299.00
Please inquire about custom configurations or bulk packaging.
  • OR

    Recombinant human Fibroblast Growth Factor-basic (bFGF) (AA134-288), also known as FGF-2 or HBGF-2, is a bioactive protein intended for use in cell culture applications. bFGF is a heparin-binding member of the FGF superfamily of molecules. It is involved in a number of biological processes including embryonic development, differentiation, survival, regeneration and migration (1-5). In addition, bFGF is a critical factor for growing embryonic stem cells in culture to remain in an undifferentiated state. Recombinant human FGF-basic is a 17.3 kDa protein consisting of 154 amino acid residues. The protein is manufactured using all non-animal reagents.


    Figure 1.    SDS Page of Recombinant Human bFGF Sample.
    Figure 2a.  NIH/3T3 (mouse fibroblast cell line, ATCC: CCL-1668) were cultured before adding bFGF.
    Figure 2b.  NIH/3T3 (mouse fibroblast cell line, ATCC: CCL-1668) were cultured with 0.25 ng/ml in serum-free medium at 37 °C, 5% CO2 for 24 hours.
    Figure 3.    bFGF-2 Activity Assay. The optical density (OD) of each concentration of the testing samples, which is directly proportional to the cell number, was read at 492 nm at the endpoint of incubation. The cell proliferation dose curve was plotted with OD 492 vs. FGF basic concentrations (ng/mL). Figure 4. iPS cell generation using the three different formulations of bFGF. Figure 5. bFGF samples in tubes.

    Figure 1

    Double click on above image to view full picture

    Zoom Out
    Zoom In

    More Views

    • Base
    • Figure 1
    • Figure 2a
    • Figure 2b
    • Figure 3

    Scientific Details

    AA Sequence:
    AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
    Endotoxin:
    Less than 0.01 ng/μg cytokine as determined by the LAL assay
    Bioactivity:
    ED50= 0.1-1.0 ng/ml as determined by the dose dependent proliferation of NIH 3T3 cells (figure-2, 3).
    Formulation:
    Sterile filtered through a 0.22 micron filter with Tris buffer (10 mM Tris pH7.5, 150 mM NaCl).
    Purification:
    Sequential chromatography
    Purity:
    Greater than 98% as determined by SDS-PAGE (figure-1)
    Source:
    Escherichia Coli
    Storage & Stability:
    The product is shipped on dry ice. Storage use a manual defrost freezer and avoid repeated freeze-thaw cycles. It is stable for 12 months from date of receipt at -20 °C to -80 °C or two weeks at 2 °C to 8 °C under sterile conditions.
    size:
    5 µg, 10 µg, 25 µg, 50 µg, 100 µg, 250 µg, 1.0 mg
    Suggested Usage:
    Useful for cell culture and for the study of signaling pathways.

    View / Download Product Data Sheets

    Documentation: